PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_49.26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 169aa    MW: 18695.3 Da    PI: 11.0857
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_49.26genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.73.8e-1690141556
                                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                                  +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+ e++ ++ 
  evm.model.supercontig_49.26  90 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELQKKQEKIMEMQ 141
                                  79******************************************99999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.4E-1684138No hitNo description
SMARTSM003386.5E-1486151IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.49688139IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.5E-1290139No hitNo description
CDDcd147074.82E-2490144No hitNo description
PfamPF001704.2E-1490142IPR004827Basic-leucine zipper domain
PROSITE patternPS00036093108IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MATNFNLKNF GNEPLADGGT SGNRPLANVP LTRQPSGRAM GVGLLQTQLS SNGIGKNNGD  60
TSSVSPVPYA FNGGFRGRKC SGAVEKVVER RQRRMIKNRE SAARSRARKQ AYTMELEAEV  120
AKLKEENEEL QKKQEKIMEM QKNQVLEMLN GQRGSKLRCL RRTQTGPW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071654.12e-66PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q43e-57AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A067D5D23e-67A0A067D5D2_CITSI; Uncharacterized protein
TrEMBLA0A067GWQ27e-67A0A067GWQ2_CITSI; Uncharacterized protein
TrEMBLA0A067L1G83e-66A0A067L1G8_JATCU; Uncharacterized protein
STRINGSolyc04g078840.2.15e-62(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Representative plantOGRP10063711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.16e-35abscisic acid responsive elements-binding factor 2